PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G138900.1.p
Common NameSb07g021430, SORBIDRAFT_07g021430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 307aa    MW: 32644 Da    PI: 6.8852
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G138900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+W++eEd+llv +v+++G+++W+++++  g+ R+ k+c++rw +yl
  Sobic.007G138900.1.p 14 KGPWSPEEDLLLVSYVQEHGPENWRAVPSNTGLMRCSKSCRLRWTNYL 61
                          79********************************************97 PP

2Myb_DNA-binding52.21.4e-1667112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg+++ +E++l++++ ++lG++ W+tIa++m   Rt++++k++w+++l
  Sobic.007G138900.1.p  67 RGNFSDQEEKLIIELQALLGNK-WSTIASYMR-DRTDNDIKNYWNTHL 112
                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.546961IPR017930Myb domain
SuperFamilySSF466893.15E-2911108IPR009057Homeodomain-like
SMARTSM007177.5E-141363IPR001005SANT/Myb domain
PfamPF002491.3E-161461IPR001005SANT/Myb domain
CDDcd001672.20E-111661No hitNo description
PROSITE profilePS5129424.26662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2365116IPR009057Homeodomain-like
SMARTSM007172.4E-1566114IPR001005SANT/Myb domain
PfamPF002497.0E-1567112IPR001005SANT/Myb domain
CDDcd001675.92E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MGRPPCCEKS GVKKGPWSPE EDLLLVSYVQ EHGPENWRAV PSNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF SDQEEKLIIE LQALLGNKWS TIASYMRDRT DNDIKNYWNT HLRKKLAKTC  120
ASESGASGGS AKTKGDGAAA PAPAPKGQWE RQLQTDMHTA RQALQEALSI DTAPPPPAAI  180
KPEPLPLAQL PAPALSPAMY ACSIENVVRV LELWMQRSAS EKASAQSMTS ISAVSGGGEG  240
GSGSQSGTAR ALEGFTGMTK VDGAGGAGPG PSSSLPMLES WLLDDGMGHG DEGLFCVPLA  300
DPCEFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-24141164105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0357491e-156BT035749.2 Zea mays full-length cDNA clone ZM_BFb0081I17 mRNA, complete cds.
GenBankKJ7278811e-156KJ727881.1 Zea mays clone pUT5974 MYB transcription factor (MYB83) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444404.10.0hypothetical protein SORBIDRAFT_07g021430
SwissprotP813921e-89MYB06_ANTMA; Myb-related protein 306
TrEMBLC5YLA00.0C5YLA0_SORBI; Putative uncharacterized protein Sb07g021430
STRINGSb07g021430.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.27e-81myb domain protein 96